![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013895687.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 119aa MW: 12717.2 Da PI: 10.2098 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 65.2 | 1.1e-20 | 58 | 115 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 dDg WrKYG K v+ + ++++Y+rCt +gCp++k + ++ +++i Y+g+Hnhe XP_013895687.1 58 DDGSYWRKYGEKAVEAQGVTKGYFRCTEPGCPARKVITKDVGTAAITTIDYRGDHNHE 115 899******************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 18.016 | 52 | 117 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.9E-15 | 57 | 116 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.2E-17 | 57 | 115 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 6.0E-19 | 57 | 115 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.8E-16 | 58 | 115 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MPHPPAHSPR ILRSSPAHSP RKRPAVEGAS PAPSPSKYKG PNGAPSPGYR GRGGSANDDG 60 SYWRKYGEKA VEAQGVTKGY FRCTEPGCPA RKVITKDVGT AAITTIDYRG DHNHEPLLN |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013895687.1 | 1e-82 | putative WRKY transcription factor 4 | ||||
TrEMBL | A0A0D2JAA2 | 2e-82 | A0A0D2JAA2_9CHLO; Putative WRKY transcription factor 4 |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP469 | 16 | 26 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G13960.1 | 2e-15 | WRKY DNA-binding protein 4 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 25728542 |
Publications ? help Back to Top | |||
---|---|---|---|
|