PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013895687.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family WRKY
Protein Properties Length: 119aa    MW: 12717.2 Da    PI: 10.2098
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013895687.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY65.21.1e-2058115259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDg  WrKYG K v+ + ++++Y+rCt +gCp++k + ++     +++i Y+g+Hnhe
  XP_013895687.1  58 DDGSYWRKYGEKAVEAQGVTKGYFRCTEPGCPARKVITKDVGTAAITTIDYRGDHNHE 115
                     899******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081118.01652117IPR003657WRKY domain
SMARTSM007744.9E-1557116IPR003657WRKY domain
SuperFamilySSF1182901.2E-1757115IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.0E-1957115IPR003657WRKY domain
PfamPF031063.8E-1658115IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MPHPPAHSPR ILRSSPAHSP RKRPAVEGAS PAPSPSKYKG PNGAPSPGYR GRGGSANDDG  60
SYWRKYGEKA VEAQGVTKGY FRCTEPGCPA RKVITKDVGT AAITTIDYRG DHNHEPLLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013895687.11e-82putative WRKY transcription factor 4
TrEMBLA0A0D2JAA22e-82A0A0D2JAA2_9CHLO; Putative WRKY transcription factor 4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4691626
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.12e-15WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]